PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G436900.1.p
Common NameLOC101759819, SETIT_030350mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 347aa    MW: 38101.6 Da    PI: 7.2683
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G436900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.32e-344296155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+WtpeLHerFveav+qLGG++kAtPkti++lm+++gLtl+h+kSHLQkYRl
  Seita.2G436900.1.p 42 KPRLKWTPELHERFVEAVQQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQKYRL 96
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.7343999IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-324097IPR009057Homeodomain-like
SuperFamilySSF466897.88E-184197IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-254297IPR006447Myb domain, plants
PfamPF002496.7E-114495IPR001005SANT/Myb domain
PfamPF143791.7E-25143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MYHQQQLHGH NQHLSSRPGL PPEKQFLLQG GDAGLVLSTD AKPRLKWTPE LHERFVEAVQ  60
QLGGPDKATP KTIMRLMGIP GLTLYHLKSH LQKYRLSKNL QAQANATNAK NVLGCRTGTD  120
KPCERNGSPA SHLNTEPQIN RSMHISEALQ MQIEVQRRLH EQLEVQRHLQ LRIEAQGKYL  180
QSVLEKAQEA LAKQNVDLDA GVLGAAAAAE TQQLSELISR ASATKCAQHE HFHHQHLGGV  240
GDGSVDSCLT ACEGSQRDHD MLSIGLSPAP TPRGGGYPFE AARSSGNERG GASTSCCEEF  300
LFLEESGTGR RGSTDEQQEL DLNINDRNTR RPRNCEKIDL NGSSWN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958726.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK52e-57APL_ARATH; Myb family transcription factor APL
TrEMBLK3ZUU00.0K3ZUU0_SETIT; Uncharacterized protein
STRINGSi030350m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.45e-86myb-related protein 1